DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dusp6 and CG15528

DIOPT Version :10

Sequence 1:NP_446335.1 Gene:Dusp6 / 116663 RGDID:70978 Length:381 Species:Rattus norvegicus
Sequence 2:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster


Alignment Length:206 Identity:60/206 - (29%)
Similarity:100/206 - (48%) Gaps:20/206 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat   167 LGGLRISS--DSSSDIESDLDRDPNSATDSDGSPLSNSQPSFP--VEILPFLYLGCAKDSTNLDV 227
            :||:.||.  .::..:|.:..::..||     |.|.:..| ||  ..|.|.|.| |...:.....
  Fly     6 VGGIAISGVPFANETVEKESRQNQLSA-----STLEDHTP-FPGLSRITPSLIL-CGAAAVVPAY 63

  Rat   228 LEEFGIKYILNVTPNLPNL-FENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLV 291
            :::.|:..::||.|.||:. ..:.....|.:|...|....:|::.|.||...|:|........|:
  Fly    64 MDKLGVSCVINVAPELPDTPLPSQKNPLYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCTLI 128

  Rat   292 HCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL-GLSSPCDN 355
            ||:||:|||.::.:||||:...:|:.:||..|:..:..:.||..|..||..:|:.| |.||    
  Fly   129 HCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLRGSSS---- 189

  Rat   356 RVPAQQLYFTA 366
               ...:||.:
  Fly   190 ---VAMVYFAS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dusp6NP_446335.1 DSP_MapKP 17..147 CDD:238723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..203 5/26 (19%)
DSP_MKP_classII 207..343 CDD:350414 42/138 (30%)
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 41/135 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.