DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OLIG1 and CG33557

DIOPT Version :9

Sequence 1:NP_620450.2 Gene:OLIG1 / 116448 HGNCID:16983 Length:271 Species:Homo sapiens
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:127 Identity:46/127 - (36%)
Similarity:63/127 - (49%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    54 STSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGA-------HPGGSARPDAKEEQQQQLRR--- 108
            |:||||.:..|:...|::     :...|...||||       ..|..|.|..:|.|....||   
  Fly     4 SSSSSSFSNYLMAVFAQD-----SNSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPR 63

Human   109 -KINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQ 169
             |||:|||.|..::|.|.:|||.:| |....:      ||||||..:.||.:||..|.|:|:
  Fly    64 QKINARERYRTFNVNSAYEALRNLI-PTEPMN------RKLSKIEIIRLASSYITHLSSTLE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OLIG1NP_620450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..117 25/73 (34%)
HLH 107..164 CDD:278439 26/60 (43%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.