DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CKS2 and Cks30A

DIOPT Version :10

Sequence 1:NP_001818.1 Gene:CKS2 / 1164 HGNCID:2000 Length:79 Species:Homo sapiens
Sequence 2:NP_476947.1 Gene:Cks30A / 34250 FlyBaseID:FBgn0010314 Length:74 Species:Drosophila melanogaster


Alignment Length:69 Identity:54/69 - (78%)
Similarity:62/69 - (89%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     4 KQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILL 68
            |.|||||||:||.:|||||:||:||.|.|||||||:|.|||.:|||||.||:|||||:|||||||
  Fly     3 KDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILL 67

Human    69 FRRP 72
            ||||
  Fly    68 FRRP 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CKS2NP_001818.1 CKS 6..73 CDD:460068 53/67 (79%)
Cks30ANP_476947.1 CKS 5..72 CDD:460068 53/67 (79%)

Return to query results.
Submit another query.