DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CKS1B and Cks85A

DIOPT Version :10

Sequence 1:NP_001817.1 Gene:CKS1B / 1163 HGNCID:19083 Length:79 Species:Homo sapiens
Sequence 2:NP_649817.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster


Alignment Length:71 Identity:51/71 - (71%)
Similarity:60/71 - (84%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPH 65
            |...||.||:||.|:.||||||:||.|:||.|||.|||:|:||||||||||.||||||:|.||||
  Fly     1 MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVHAPEPH 65

Human    66 ILLFRR 71
            ::||||
  Fly    66 VILFRR 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CKS1BNP_001817.1 CKS 6..73 CDD:460068 49/66 (74%)
Cks85ANP_649817.1 CKS 6..73 CDD:460068 49/66 (74%)

Return to query results.
Submit another query.