DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angpt4 and CG31832

DIOPT Version :9

Sequence 1:NP_033771.1 Gene:Angpt4 / 11602 MGIID:1336887 Length:509 Species:Mus musculus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:189 Identity:67/189 - (35%)
Similarity:100/189 - (52%) Gaps:8/189 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse   320 KPLKVFCDMETDGGGWTLIQHREDGSVNFQRTWEEYKEGFGNVAREHWLGNEAVHRLTSRTAYLL 384
            :|.:| ...:|....|.:||.|.||||||.::|..||:|||:...|.::|.:.::.:|....:.|
  Fly    42 EPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHEL 105

Mouse   385 RVELHDWEGRQTSIQYENFQLGSERQRYSLS-VNDSSSSAGRKNSLAPQ-GTKFSTKDMDNDNCM 447
            .::|....|......:::||:.||.:.|.|. |...|.:||  :||... ..:|||.|.|||...
  Fly   106 FIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG--DSLRYHINKRFSTFDRDNDESS 168

Mouse   448 CKCAQMLSGGWWFDACGLSNLNGIYYSVHQHLHKINGIRWHYFRGPSYSLHGTRMMLRP 506
            ..||....|||||.:|..|:|||:|:. ......:|||.|.  |....||...::|:||
  Fly   169 KNCAAEHGGGWWFHSCLSSSLNGLYFR-EGETGMLNGIHWG--RWKFQSLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angpt4NP_033771.1 BMFP 140..217 CDD:294701
FReD 292..507 CDD:238040 67/189 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..436 6/20 (30%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 67/189 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.