DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angpt2 and CG9500

DIOPT Version :9

Sequence 1:NP_031452.2 Gene:Angpt2 / 11601 MGIID:1202890 Length:496 Species:Mus musculus
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:314 Identity:93/314 - (29%)
Similarity:136/314 - (43%) Gaps:50/314 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse   189 SFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLME 253
            ||...:.:|.|   |.|..:....|.||:   |....|:..||:....|:..|  :||...||..
  Fly    14 SFYSTEAMDSE---SFQNDTAIRNKPELK---SLYKLVLALLEENQSNASTEN--IQKSSSDLNT 70

Mouse   254 TVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVG 318
            |               .::.|...|......|.         ||||:.. ...:..:..||.::.
  Fly    71 T---------------GLSGRYPSQCPTYPPAH---------GIYTVQV-LGLKPFQVSCDAEIA 110

Mouse   319 GGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEA 383
            |.||||:..|....::|.|:|.|||.|||...|::::|.:.:..:|....:.|.|.|:|:||...
  Fly   111 GTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTR 175

Mouse   384 HSLYDHFYLAGEESNYRIHLTG-LTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWF 447
            ::.||..::..|...|.:...| .||.||. |.|.....:|||.|.|||.....|::...|.||.
  Fly   176 YAHYDEIFIESENKFYAMTKLGEFTGDAGD-SMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWH 239

Mouse   448 DACGPSNL--------NGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRP 493
            ..|..|||        .|||:       ::.||.|:.|:...||.|...||:||
  Fly   240 LNCTYSNLFGIYVKGDEGQYF-------QWKGIVWHSWRTESYSYKVMQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angpt2NP_031452.2 RILP-like <168..226 CDD:304877 10/36 (28%)
FBG 280..494 CDD:214548 71/223 (32%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 73/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.