DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angpt2 and CG31832

DIOPT Version :9

Sequence 1:NP_031452.2 Gene:Angpt2 / 11601 MGIID:1202890 Length:496 Species:Mus musculus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:203 Identity:76/203 - (37%)
Similarity:105/203 - (51%) Gaps:7/203 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse   295 SGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEF 359
            :||:.|..|.  ||.............|.|||.|.||||:|.::|..||:|||.|.||:::|.:.
  Fly    31 NGIHQLMLPE--EEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQK 93

Mouse   360 VSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTG-LTGTAGKISSISQPGSDF 423
            :..:|.:..:.|.||||...|...::.:|.|.:..|...|::...| .:||||. |........|
  Fly    94 LYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGD-SLRYHINKRF 157

Mouse   424 STKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATT 488
            ||.|.|||:....|:....|||||.:|..|:|||.|: ::..|...|||.|..||..  ||....
  Fly   158 STFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYF-REGETGMLNGIHWGRWKFQ--SLTFVQ 219

Mouse   489 MMIRPADF 496
            :||||..|
  Fly   220 IMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angpt2NP_031452.2 RILP-like <168..226 CDD:304877
FBG 280..494 CDD:214548 74/199 (37%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 74/199 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.