DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angpt1 and CG9500

DIOPT Version :9

Sequence 1:NP_033770.2 Gene:Angpt1 / 11600 MGIID:108448 Length:498 Species:Mus musculus
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:288 Identity:92/288 - (31%)
Similarity:135/288 - (46%) Gaps:32/288 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse   210 DTLKEEKENLQGLVSRQTFIIQELEKQLSRATNNNSILQKQQLELMDTVHNLISLCTKEGVLLKG 274
            ||....|..|:.|..   .::..||:..|.|:..|  :||...:|..|           |:   .
  Fly    29 DTAIRNKPELKSLYK---LVLALLEENQSNASTEN--IQKSSSDLNTT-----------GL---S 74

Mouse   275 GKREEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQR 339
            |:...:.|....|         .||||:....: :|.:|.|:.::.|.||||:..|....|:|.|
  Fly    75 GRYPSQCPTYPPA---------HGIYTVQVLGL-KPFQVSCDAEIAGTGWTVMARRTSNKLNFFR 129

Mouse   340 GWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLY 404
            .|.|||.|||...|::::|.:.:.|||..:.:.|.|.|.|:||...|:.||...|.:|.:.|.:.
  Fly   130 SWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMT 194

Mouse   405 LKGH-TGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQ-N 467
            ..|. ||.|| .|.:.....:|||.|.|||.....||....|.||...|..|||.|::....: .
  Fly   195 KLGEFTGDAG-DSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQ 258

Mouse   468 HGKLNGIKWHYFKGPSYSLRSTTMMIRP 495
            :.:..||.||.::..|||.:...||:||
  Fly   259 YFQWKGIVWHSWRTESYSYKVMQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angpt1NP_033770.2 RILP-like <133..238 CDD:304877 7/27 (26%)
FReD 281..496 CDD:238040 76/217 (35%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 76/222 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.