DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angpt1 and CG31832

DIOPT Version :9

Sequence 1:NP_033770.2 Gene:Angpt1 / 11600 MGIID:108448 Length:498 Species:Mus musculus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:177 Identity:72/177 - (40%)
Similarity:104/177 - (58%) Gaps:7/177 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse   324 WTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQ 388
            |.|||.|.|||::|.:.|..||.|||:|:||:::|.:.::.:|.::.:.|.|:|....|...|:.
  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAH 120

Mouse   389 YDRFHIGNEKQNYRLYLKG-HTGTAGKQSSLILH-GADFSTKDADNDNCMCKCALMLTGGWWFDA 451
            :|.|.:.:|.:.|:|...| ::||||  .||..| ...|||.|.|||.....||....|||||.:
  Fly   121 FDDFQVDSETELYKLERVGKYSGTAG--DSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHS 183

Mouse   452 CGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF 498
            |..|:|||:::..|:. |.||||.|..:|  ..||....:||||..|
  Fly   184 CLSSSLNGLYFREGET-GMLNGIHWGRWK--FQSLTFVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angpt1NP_033770.2 RILP-like <133..238 CDD:304877
FReD 281..496 CDD:238040 70/173 (40%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 70/173 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.