DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CKMT2 and CG5144

DIOPT Version :9

Sequence 1:NP_001093205.1 Gene:CKMT2 / 1160 HGNCID:1996 Length:419 Species:Homo sapiens
Sequence 2:NP_648284.1 Gene:CG5144 / 39040 FlyBaseID:FBgn0035957 Length:388 Species:Drosophila melanogaster


Alignment Length:408 Identity:155/408 - (37%)
Similarity:225/408 - (55%) Gaps:52/408 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     9 LTGRNASLLFATMGTSVLTTGYLLNRQ----KVCAEVREQP----RLFPPSADYPDLRKHNNCMA 65
            |.||.|.|              ::||.    .|..||.||.    :....|.....|:||     
  Fly    13 LLGRCAQL--------------VINRHASKGNVDKEVMEQMEKGYKKLAESKSKSLLKKH----- 58

Human    66 ECLTPAIYAKLRNKVTPN-GYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKL 129
              ||..|:.||:.|.||: ..||..||.:|:.|  |.  ..||:.|.|.|:|:||||||||||:.
  Fly    59 --LTKEIFEKLKTKTTPSFNSTLLHCISSGMCN--HD--SGVGLYAPDPEAYKVFADLFDPVIEE 117

Human   130 RHNGYDPRVMKHTTDLDASKITQG-QF-----DEHYVLSSRVRTGRSIRGLSLPPACTRAERREV 188
            .|     :..|.|....|:...:| .|     |.|:::|:|||.||:::|....|..|.|:..|:
  Fly   118 YH-----KCFKKTDKQPATAFGKGADFENLDPDGHFIVSTRVRCGRAVKGYPFNPCLTEADYMEL 177

Human   189 ENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWH 253
            |:....|:..|.|:..|:|..|:.|.:..|::||:||:|| |.....|..||.:|.||..|||:.
  Fly   178 ESKICGAVTSLTGEYKGKYMPLTGMDKCIQEQLIEDHYLF-KEGDRFLASAGASRYWPTGRGIFL 241

Human   254 NYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCP 318
            |..|.||:|.|||||.|:|||||||::.:|::|...|::.:.:.:|     |..:||||::..||
  Fly   242 NSAKNFLVWCNEEDHIRIISMEKGGDLGKVYDRMVGGVEALGKQLQ-----FNRDERLGFLTFCP 301

Human   319 SNLGTGLRAGVHVRIPKLSKDP-RFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVE 382
            :||||.:||.||:::|.|..|| ...|:.:..|||.|||.|..:.|...|:||||..|:|.:|.|
  Fly   302 TNLGTSIRASVHIKLPNLMCDPDEMKKLADKYRLQIRGTSGEHSEAKGGVHDISNQRRMGLTEYE 366

Human   383 LVQIVIDGVNYLVDCEKK 400
            :::.:.||:..|::.|.|
  Fly   367 IIKEMHDGIKGLIEAECK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CKMT2NP_001093205.1 Cardiolipin-binding. /evidence=ECO:0000250 40..64 8/27 (30%)
creatine_kinase_like 50..407 CDD:153076 143/359 (40%)
CG5144NP_648284.1 arginine_kinase_like 40..382 CDD:153079 141/363 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 196 1.000 Domainoid score I3115
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2904
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58958
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm8556
orthoMCL 1 0.900 - - OOG6_100675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.