DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Acan and lectin-22C

DIOPT Version :9

Sequence 1:	NP_001348429.1	Gene:	Acan / 11595	MGIID:	99602	Length:	2170	Species:	Mus musculus
Sequence 2:	NP_001137766.1	Gene:	lectin-22C / 7354375	FlyBaseID:	FBgn0259230	Length:	263	Species:	Drosophila melanogaster

Alignment Length:	109	Identity:	33/109 - (30%)
Similarity:	48/109 - (44%)	Gaps:	14/109 - (12%)

- Green bases have known domain annotations that are detailed below.

Mouse  1979 ETWVDAERRCREQQSHLSSIVTPEEQEFVNKNAQD--YQWIGLNDRTIEGDF-RWSDGHSLQFEK 2040
            :.|..|.:.||....||:.|....:...:..|.::  :.|:|:||...||.| ....|....|.|
  Fly   155 KNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLK 219

Mouse  2041 W---RPNQPDNFFATGEDCVVMIWHERGEWNDVPCNYQLPFTCK 2081
            |   ||:|.|..     :||.:.   .||..|.||:|...|.|:
  Fly   220 WASGRPSQLDTL-----NCVFLY---NGEMYDYPCHYTFRFICQ 255

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Acan	NP_001348429.1	Ig_Aggrecan	43..154	CDD:143308
		G1-A	48..140
		G1-B	152..247
		Link_domain_CSPGs_modules_1_3	153..247	CDD:239594
		G1-B'	253..349
		Link_domain_CSPGs_modules_2_4	254..349	CDD:239597
		G2-B	486..580
		Link_domain_CSPGs_modules_1_3	487..581	CDD:239594
		G2-B'	587..682
		Link_domain_CSPGs_modules_2_4	588..683	CDD:239597
		KS	685..803
		Herpes_ICP4_C	689..>1027	CDD:332854
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	737..1079
		CS-1	805..1231
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1108..1239
		AidA	<1171..>1630	CDD:330218
		Cell attachment site. /evidence=ECO:0000255	1171..1173
		CS-2	1232..1917
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1299..1465
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1491..1538
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1586..1671
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1782..1838
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1861..1914
		EGF_CA	1918..1954	CDD:238011
		CLECT_CSPGs	1960..2083	CDD:153058	33/109 (30%)
		CCP	2087..2143	CDD:153056
lectin-22C	NP_001137766.1	CLECT	146..255	CDD:153057	32/107 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R4956
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940