DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CKM and Argk

DIOPT Version :9

Sequence 1:NP_001815.2 Gene:CKM / 1158 HGNCID:1994 Length:381 Species:Homo sapiens
Sequence 2:NP_729446.1 Gene:Argk / 39041 FlyBaseID:FBgn0000116 Length:562 Species:Drosophila melanogaster


Alignment Length:359 Identity:158/359 - (44%)
Similarity:222/359 - (61%) Gaps:17/359 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    15 KPEEEYPDL--SKHNNHMAKVLTLELYKKLRDKETPS-GFTVDDVIQTGVDNPGHPFIMTVGCVA 76
            |.||.|..|  |...:.:.|.||.|::..|::|.||: ..|:.||||:|::|  |.  ..||..|
  Fly   215 KLEEGYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLEN--HD--SGVGIYA 275

Human    77 GDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDP--NYVLSSRVRTGRSIKG 139
            .|.|:|.||.:||||||.|.|||:|.||||... |..::....::||  .||:|:|||.|||::|
  Fly   276 PDAEAYTVFADLFDPIIEDYHGGFKKTDKHPAS-NFGDVSTFGNVDPTNEYVISTRVRCGRSMQG 339

Human   140 YTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLA 204
            |...|..:..:.:.:|......|:.|.||.|||:|||..|.:..||||||||||| |.....|.|
  Fly   340 YPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLF-KEGDRFLQA 403

Human   205 SGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGH 269
            :...|.||..|||:|||.|:||||.|||||||:|||::||::.::::|....:.:||   |:.  
  Fly   404 ANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIE---KRV-- 463

Human   270 PFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHL-SKHPKFEEILTRLRLQKRGTGGVDTAAVGSV 333
            ||..:..||::..||:||||.:|..||:|:..| |...|.||:..:..||.|||.|..|.|.|.|
  Fly   464 PFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGV 528

Human   334 FDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKL 367
            :|:||..|:|.:|.|.|:.:.||:..::::||.|
  Fly   529 YDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CKMNP_001815.2 creatine_kinase_like 16..373 CDD:153076 157/358 (44%)
ArgkNP_729446.1 arginine_kinase_like 215..562 CDD:153079 157/357 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147547
Domainoid 1 1.000 196 1.000 Domainoid score I3115
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2904
Isobase 1 0.950 - 0 Normalized mean entropy S3995
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm8556
orthoMCL 1 0.900 - - OOG6_100675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2592
SonicParanoid 1 1.000 - - X315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.640

Return to query results.
Submit another query.