DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC5A11 and CG33124

DIOPT Version :9

Sequence 1:NP_001339171.1 Gene:SLC5A11 / 115584 HGNCID:23091 Length:675 Species:Homo sapiens
Sequence 2:NP_001097056.3 Gene:CG33124 / 318891 FlyBaseID:FBgn0053124 Length:588 Species:Drosophila melanogaster


Alignment Length:625 Identity:137/625 - (21%)
Similarity:243/625 - (38%) Gaps:156/625 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    28 DIAVLVLYFLFVLAVGL---WSTVKTKR-------DT------------VKGYFLAGGDMVWWPV 70
            |..|.:...:..:|:||   | ..|||:       ||            :..|.:..|.:..:||
  Fly    10 DYTVFLGVTILSIAIGLYFGW-IKKTKKEMESSPADTPEISIPNFGSKKMNEYLMGSGHLKVFPV 73

Human    71 GASLFASNVGSGHFIGLAGS----GAATGISVSAYELNGLFSVLMLAWIFLPIYIAGQVTTMPEY 131
            ..||.||.:.....:|....    |....:.|.|..:.|    |.:::|:||::.|.||.:..||
  Fly    74 AMSLIASFISGVAILGNPSEIYYYGTQYSLIVLAIVIQG----LAVSYIYLPVFSALQVRSSYEY 134

Human   132 LRKRFGGIRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITAVYTVAGG 196
            |..||..:...|:..:..:.:.::|...|  :..|:.:.|:..|::::..|.::.:..:||:.||
  Fly   135 LGMRFHPLIRNIVSIMFVIEVLLYTPFVV--FVPALALNQASGLNIHMIEVLIIVVCVIYTLLGG 197

Human   197 LAAVIYTDALQTLIMLIGALTLMGYSFAAVGGMEGLKEKYFLALASNRSENSSCGLPREDAFHIF 261
            |.||::||..|.:||           ||:|..:..|...|...|              :|.|...
  Fly   198 LKAVVHTDIWQVVIM-----------FASVVVVAILATCYITDL--------------DDFFESL 237

Human   262 RD------------PLTSDLPWPGVLFGMSIPSLWYW----CTDQVIVQRTLAAKNLSHAKGGAL 310
            .|            |...:..|..|:.|     .:||    ...|.:|.|.::..||..|:....
  Fly   238 VDGGRLIFGNINPSPYVRNTVWSVVIGG-----AFYWTSITAVHQTMVHRYMSLPNLKMARTSIA 297

Human   311 MAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKICSNPSGCSDIAYPKLVLELLP--TGL 373
            ......::...::.|.|::...::.|    .||....:|.:|     |...|..|::.:.  .|:
  Fly   298 FFVLGSIIFYSVLSFLGLLIFNMYKD----CDPLSAGQIMNN-----DQLVPLFVVQSVGHIYGI 353

Human   374 RGLMMAVMVAALMSSLTSIFNSASTIFTMDLWN---HLRPRASEKELMIVGRVFVL-LLVLVSIL 434
            .||.:|.:..|.:|||:...||.|.:...|:..   .::|..:...:::...:.:: .||...:|
  Fly   354 PGLFIAGIFGAGLSSLSVFLNSTSLVILQDIVRGCFKMQPGETASAIIVKATIVIMGALVFGEVL 418

Human   435 WIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCF-------WKRTNEKGAFWGLISGLLL-G 491
            .:..|    .|.|.|.:..::      :|.....|.|       |  .|..|...|.|:|.|| |
  Fly   419 LLEKV----SGILSICMSLVA------IATSSTFGIFTLAVLVPW--ANTVGTAVGGIAGFLLTG 471

Human   492 LV----------------RLVL------------DFIYVQPRCDQPDERPVLVKSIHYLYFSMIL 528
            .:                ||.:            :.::|    |:....|:...|.|::   ..:
  Fly   472 WITFGSQIAAASGQLHHHRLPVSVASCPGNVTARENVWV----DEEQVFPLFRLSFHWI---NPI 529

Human   529 STVTLITV-STVSWFTEPPS-KEMVSHLTWFTRHDPVVQK 566
            ..:|::.| |.||..|:|.. |.:.|.|.     .||:.:
  Fly   530 GALTVVVVGSLVSLVTKPTDIKSLDSDLI-----SPVIHR 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC5A11NP_001339171.1 SLC5sbd_SGLT6 28..675 CDD:271381 137/625 (22%)
CG33124NP_001097056.3 SLC5sbd_NIS-SMVT 9..533 CDD:271383 125/587 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.