| Sequence 1: | NP_001271309.1 | Gene: | Adra1b / 11548 | MGIID: | 104774 | Length: | 515 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262774.1 | Gene: | Oamb / 43982 | FlyBaseID: | FBgn0024944 | Length: | 751 | Species: | Drosophila melanogaster |
| Alignment Length: | 759 | Identity: | 198/759 - (26%) |
|---|---|---|---|
| Similarity: | 261/759 - (34%) | Gaps: | 345/759 - (45%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 20 LKDANFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFI 84
Mouse 85 VNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRY 149
Mouse 150 SLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEP--------------------------- 187
Mouse 188 -----------------------------------APNDDK------------------------ 193
Mouse 194 -------------------------------ECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVY 227
Mouse 228 IVAKRTTKNLEAGVMKEMSNSK---------ELTLRIH--------------------------- 256
Mouse 257 ---------------------------SKNFHE---------------DTLSSTKAKGHNPRSSI 279
Mouse 280 AVKLF--------------------------------------------------------KFSR 288
Mouse 289 EKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSK 353
Mouse 354 EFKRAFMRILGCQC-------------RGG-----RRRRRRRRL--GGCAYTY------------ 386
Mouse 387 -RPWTRG-GSLERSQS-----RKDSL-------------------------DDSGSCMSGSQRTL 419
Mouse 420 PSASPSPGYLGRGTQ-PPVELCAFPEWKPGALLSLPEPPGRRGR 462 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Adra1b | NP_001271309.1 | 7tmA_alpha1B_AR | 46..359 | CDD:320449 | 152/563 (27%) |
| TM helix 1 | 47..73 | CDD:320449 | 10/25 (40%) | ||
| TM helix 2 | 80..106 | CDD:320449 | 19/25 (76%) | ||
| TM helix 3 | 118..148 | CDD:320449 | 21/29 (72%) | ||
| TM helix 4 | 160..183 | CDD:320449 | 9/22 (41%) | ||
| TM helix 5 | 200..229 | CDD:320449 | 15/28 (54%) | ||
| TM helix 6 | 287..317 | CDD:320449 | 18/29 (62%) | ||
| TM helix 7 | 327..352 | CDD:320449 | 13/24 (54%) | ||
| Nuclear localization signal. /evidence=ECO:0000250 | 368..378 | 5/14 (36%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 392..430 | 14/68 (21%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 474..515 | ||||
| Oamb | NP_001262774.1 | 7tm_4 | 29..>154 | CDD:304433 | 68/133 (51%) |
| 7tm_1 | 37..>181 | CDD:278431 | 68/143 (48%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 291 | 1.000 | Inparanoid score | I2771 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1095345at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.970 | |||||