DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBP4 and atl

DIOPT Version :9

Sequence 1:NP_443173.2 Gene:GBP4 / 115361 HGNCID:20480 Length:640 Species:Homo sapiens
Sequence 2:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster


Alignment Length:464 Identity:107/464 - (23%)
Similarity:189/464 - (40%) Gaps:80/464 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    31 NQEEQLTVNSKAL-------EILDKISQPVVVVAIVGLYRTGKSYLM-----------------N 71
            ::|....:|..||       |:.|:.   |.||::.|.:|.|||:|:                 :
  Fly    12 SEEHTFVLNEDALSEVLMRDEVKDRF---VCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATD 73

Human    72 RLAGKRN---GFPLGSTVQSETKGIWMWCVPHL-SKPNH---TLVLLDTEGLGDVEKSNPKNDSW 129
            .|.|:.:   ||......:.:|.||.||....| ..||.   .::||||:|..| .:|..::.:.
  Fly    74 WLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFD-SQSTVRDCAT 137

Human   130 IFALAVLLSSSFVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAEDSSEFASFFPDFIWT 194
            :|||:.:|||..:||....|....|:.|...||...|..|.:..:|            |....:.
  Fly   138 VFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKP------------FQRLQFL 190

Human   195 VRDFTLELKLDGNPITEDEYLENALKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVFDRP----- 254
            |||::...:.:...:..|:.|:..|::...::|::|:.   |..|...|.:..||:...|     
  Fly   191 VRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSL---RRHISSCFTEVACFLMPHPGLNVA 252

Human   255 TNDKQYLNHMDEVPEENLERH----FLMQSDNFCSYIFTHAKTKTLREGIIVTGKRLGTLVVTYV 315
            ||.|......|..||......    .|:..||.   ::.....:.:|      .:.|.....:|:
  Fly   253 TNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNL---VYKEISGQRVR------ARDLIQYFQSYM 308

Human   316 DAINSGAVPCLENAVTALAQLENPAAVQRAADHYSQQMAQ-----QLRLPTDTLQELLDVHAACE 375
            :......:|..::.:.|.|:..:..||..|.:.|.|.|.:     :..|.|..||   ..|...:
  Fly   309 NIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQ---TEHLRVK 370

Human   376 REAIAVF---MEHSFKDENHEFQKKLVDTIEKKKGDFVLQNEEASA-KYCQAELKRLSEHLTESI 436
            .:|:..|   .:...::...:|:|:|.|.:|:...::...||..:. |..:......:..:...|
  Fly   371 DKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKNIFKAARTPAVYFACAVIMYI 435

Human   437 LRGIFSVPG 445
            |.|||.:.|
  Fly   436 LSGIFGLVG 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBP4NP_443173.2 GTPase domain (Globular). /evidence=ECO:0000250 1..325 77/333 (23%)
GBP 33..296 CDD:280433 74/302 (25%)
GBP_C 298..594 CDD:202427 32/157 (20%)
GBP_C 304..594 CDD:293879 32/151 (21%)
coiled coil 563..574 CDD:293879
coiled coil 583..594 CDD:293879
atlNP_001287506.1 GBP 14..289 CDD:280433 74/296 (25%)
MSC <316..>471 CDD:286487 30/132 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.