DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBP4 and atln-2

DIOPT Version :9

Sequence 1:NP_443173.2 Gene:GBP4 / 115361 HGNCID:20480 Length:640 Species:Homo sapiens
Sequence 2:NP_502809.2 Gene:atln-2 / 189829 WormBaseID:WBGene00012763 Length:520 Species:Caenorhabditis elegans


Alignment Length:438 Identity:93/438 - (21%)
Similarity:176/438 - (40%) Gaps:97/438 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    25 PICLV---ENQEEQLTVNSKAL-EILDK---ISQPVVVVAIVGLYRTGKSYLMNRLAG------- 75
            |:.::   ..|..:..:|..|| .:|..   .::.:|::::.|.:|.|||:|:|....       
 Worm    29 PVQIIAPSSTQPGKFRLNESALNSVLGHSACANKKIVIISVAGAFRKGKSFLLNFFLEYLYSLHK 93

Human    76 ---------------KRNGFPLGSTVQSETKGIWMWCVP----HLSKPNHTLVLLDTEGLGDVEK 121
                           :.:||...:.|:.:|.|||:|..|    .::.....:||:||:|..| ..
 Worm    94 SQQSDSSLEWLTDDCQLHGFHWRAGVKRDTVGIWLWGEPIMIESVTGEMFAVVLMDTQGTFD-NN 157

Human   122 SNPKNDSWIFALAVLLSSSFVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAEDSSEFAS 186
            |..:....:|||:.::||..:||.|..|...||:.|....|...:          ..|....|..
 Worm   158 STYQQCMTVFALSTIVSSVQIYNVVDNIQEDALQHLSLFVEYGRI----------AMEQPHNFGK 212

Human   187 FFPDFIWTVRDFTLELKLDGNPITEDEYLENALKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVF 251
            .|...::.||||..:.:.:.......::|:|.|:..|.:..:|:   ..||.:|.:|...:|::.
 Worm   213 PFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNPEQPEEIK---QVRELLREYFEDIQCYLL 274

Human   252 DRP----TNDKQYLNHMDEVP---EENLER--------HFLMQSDNFCSYIFTHAKTKTLREGII 301
            ..|    ...:.:..|:.::.   .|.|::        |.|              |.|.: .|..
 Worm   275 PHPGYKVAERQSFRGHVKDLRPLFREELKKMVPNLLGPHIL--------------KPKIV-NGKT 324

Human   302 VTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYSQQMAQQ---LRLPTDT 363
            ||.:::......|..:.:...:|..::.:.|.|:|....|...|..:||:.|.:.   .|:.:: 
 Worm   325 VTCRKMIQYFKEYAASFDGETLPQPQSILNANAKLICIEAAHEAKVNYSRGMDRSTYGTRMMSE- 388

Human   364 LQELLDVHA-----------ACER----EAIAVFMEHSFKDENHEFQK 396
             ::||:.|.           .|.|    |...:.:|...:|.|.|.:|
 Worm   389 -KKLLEAHIKHGITALNIFDKCPRIGAKEVRNLLLEKLQEDINAELEK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBP4NP_443173.2 GTPase domain (Globular). /evidence=ECO:0000250 1..325 72/347 (21%)
GBP 33..296 CDD:280433 66/307 (21%)
GBP_C 298..594 CDD:202427 25/117 (21%)
GBP_C 304..594 CDD:293879 22/111 (20%)
coiled coil 563..574 CDD:293879
coiled coil 583..594 CDD:293879
atln-2NP_502809.2 P-loop_NTPase 41..310 CDD:393306 62/282 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.