DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBP4 and atln-1

DIOPT Version :9

Sequence 1:NP_443173.2 Gene:GBP4 / 115361 HGNCID:20480 Length:640 Species:Homo sapiens
Sequence 2:NP_001023492.1 Gene:atln-1 / 177059 WormBaseID:WBGene00021868 Length:573 Species:Caenorhabditis elegans


Alignment Length:511 Identity:117/511 - (22%)
Similarity:195/511 - (38%) Gaps:128/511 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     3 ERTLHAAVPTPGYPESESIMMAP-----ICLVENQEEQLTVNSKALE--ILD-KIS-QPVVVVAI 58
            |...|......|:.|...:...|     :.:||:.:....:|::.||  :|| |:: :.|.|:.:
 Worm     8 EHNEHQQQQHAGHVEDVLLPKEPQAVRVVEVVEDTDHSFELNTELLEKILLDPKVADKKVAVIGV 72

Human    59 VGLYRTGKSYLMN-------------RLAGK--------------RNGFPLGSTVQSETKGIWMW 96
            .|.||.|||:|:|             ::.|:              .:||......:.:|.||.:|
 Worm    73 AGAYRKGKSFLLNFFLRYLTWRSKADKVMGEVELDNSQWMSPNSPLSGFSWRGGSERDTNGILIW 137

Human    97 CVPHLSKPNH----TLVLLDTEGLGDVEKSNPKNDSWIFALAVLLSSSFVYNSVSTINHQALEQL 157
            ..|.:.|..:    .::|:||:|..| .:|..|:.:.||||:.::||..:||....|....|:.|
 Worm   138 SEPFIMKDKNGEEIAVLLMDTQGAFD-SQSTVKDCATIFALSTMISSVQIYNLSQNIQEDDLQHL 201

Human   158 HYVTELAELIRAKSCPRPDEAEDSSEFASFFPDFIWTVRDFTL----ELKLDGNPITEDEYLENA 218
            ...||...|....|..:|            |...::.|||::.    |....|.....|..||.:
 Worm   202 QLFTEYGRLALEDSASKP------------FQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVS 254

Human   219 LKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVFDRP-----TN----------DKQYLNHMDEVP 268
            .|    ::.::|..   |:.||..|...:||:...|     ||          :.::...:..:.
 Worm   255 EK----QHAELQQL---RQHIRSCFEDIRCFLMPHPGLKVATNPNFDGKLVDIENEFQQQLGVMI 312

Human   269 EENLERHFLMQSDNFCSYIFTHAKTKTLREGIIVTGKRLGTLVVTYVDAINSGAVPCLENAVTAL 333
            ...|:.|.|:..:       .:.:..|.||        |......|:.......:|..::.:.|.
 Worm   313 PRLLDSHALVHKE-------INGQKMTCRE--------LLEYFKAYMHIFRGQDLPEPKSMLMAT 362

Human   334 AQLENPAAVQRAADHYSQQMAQQL--RLPTDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQK 396
            |:..|.|||..|...|.::|.:..  ..|..:..|||:.|...:..||            .||:.
 Worm   363 AEANNLAAVASARAVYQREMEEVCGGDTPYMSTNELLEHHDRVKNIAI------------REFRN 415

Human   397 KLVDTIEKKKG--DFVLQNEEASAKYCQAELKRLSEHLTESILRGIFSVPGGHNLY 450
                  .:|.|  ||.:|           .|:||...|.|| ......|..|.||:
 Worm   416 ------ARKMGGVDFSMQ-----------FLERLESDLQES-YENYLKVNNGKNLF 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBP4NP_443173.2 GTPase domain (Globular). /evidence=ECO:0000250 1..325 83/380 (22%)
GBP 33..296 CDD:280433 71/316 (22%)
GBP_C 298..594 CDD:202427 37/157 (24%)
GBP_C 304..594 CDD:293879 36/151 (24%)
coiled coil 563..574 CDD:293879
coiled coil 583..594 CDD:293879
atln-1NP_001023492.1 P-loop_NTPase 43..325 CDD:393306 71/301 (24%)
GBP_C 351..>447 CDD:308475 30/125 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.