DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and Cirbp

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:XP_006241075.3 Gene:Cirbp / 81825 RGDID:620756 Length:176 Species:Rattus norvegicus


Alignment Length:176 Identity:166/176 - (94%)
Similarity:169/176 - (96%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMM 65
            ||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMM 65

Human    66 AMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFES 130
            |||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||.||||
  Rat    66 AMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFES 130

Human   131 RSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYGKSHSEGAT 176
            ||||||||||||:||||.|.|..|||||||||||||||||.|:|||
  Rat   131 RSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYGKSGSKGAT 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 85/86 (99%)
RRM_CIRBP_RBM3 6..85 CDD:240895 77/78 (99%)
CirbpXP_006241075.3 RRM_CIRBP_RBM3 6..85 CDD:409883 77/78 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83696139
Domainoid 1 1.000 186 1.000 Domainoid score I26110
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H980
Inparanoid 1 1.050 336 1.000 Inparanoid score I14168
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG43500
OrthoDB 1 1.010 - - D89316at314146
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 1 1.000 - - oto135450
orthoMCL 1 0.900 - - OOG6_100265
Panther 1 1.100 - - LDO PTHR48034
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X860
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1616.410

Return to query results.
Submit another query.