DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and cirbpa

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_001017797.1 Gene:cirbpa / 550495 ZFINID:ZDB-GENE-050417-329 Length:185 Species:Danio rerio


Alignment Length:184 Identity:113/184 - (61%)
Similarity:124/184 - (67%) Gaps:23/184 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     3 SDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAM 67
            |||||||:|||||||.|||||..|||||.|:.|.|.::|||.||||||||||||.||||||:..|
Zfish     2 SDEGKLFIGGLSFDTTEQSLEDAFSKYGVITNVHVARNRETNRSRGFGFVTFENPDDAKDALEGM 66

Human    68 NGKSVDGRQIRVDQAGK---SSDNRSRG---YRGGS---AGGRGFFRGGRGR-GRGFSRGGGDRG 122
            ||||||||.||||:|||   ....||.|   ||||.   .||.||||||||| |.|...|||||.
Zfish    67 NGKSVDGRTIRVDEAGKGGGGGGGRSGGGGSYRGGGGGRGGGGGFFRGGRGRGGGGGGYGGGDRS 131

Human   123 Y-------GGNRFESRSGGY--GGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSY 167
            |       ||..::|..|||  ||...|  :|.:..||.||||  ||:|.||||
Zfish   132 YGDRSYGGGGGGYKSGGGGYSSGGGGGY--NRDRGSGYGDRSS--SYKDGYDSY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 64/89 (72%)
RRM_CIRBP_RBM3 6..85 CDD:240895 61/81 (75%)
cirbpaNP_001017797.1 RRM <2..>81 CDD:223796 61/78 (78%)
RRM_SF 5..83 CDD:302621 59/77 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I23809
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H980
Inparanoid 1 1.050 197 1.000 Inparanoid score I11056
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG43500
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100265
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X860
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1111.470

Return to query results.
Submit another query.