DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and SC35

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:169 Identity:62/169 - (36%)
Similarity:87/169 - (51%) Gaps:24/169 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72
            |.|..|::.|..:.|.:||.:.|::.::.:.:||.|:.||||.||.|.:..||:||:.||:|:.:
  Fly    25 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRML 89

Human    73 DGRQIRVDQA--GK-SSDNRSRGYRGGSAGGRGFFRGGRGRGRG------FSRGGGDRGYGGNRF 128
            |||::||..|  |: ||..||...|.|..||.|  .|||.|.|.      .||....|.|..:|.
  Fly    90 DGRELRVQMARYGRPSSPTRSSSGRRGGGGGGG--SGGRRRSRSRSPMRRRSRSPRRRSYSRSRS 152

Human   129 E-----------SRSGGYGGSRDYYSSRSQSGGYSDRSS 156
            .           |||...|.||:  ...|.|||.:..:|
  Fly   153 PGSHSPERRSKFSRSPVRGDSRN--GIGSGSGGLAPAAS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 32/79 (41%)
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 29/71 (41%)

Return to query results.
Submit another query.