DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and eIF4H1

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_001285330.1 Gene:eIF4H1 / 49809 FlyBaseID:FBgn0262734 Length:388 Species:Drosophila melanogaster


Alignment Length:206 Identity:61/206 - (29%)
Similarity:88/206 - (42%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     9 FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVD 73
            |||.|.....:..:.::|..: ::..|.:||||||.:.:||.:|.||.:|:.:.|:      ..|
  Fly    32 FVGNLPQGLVQGDVIKIFQDF-EVKYVRLVKDRETDQFKGFCYVEFETLDNLERAL------ECD 89

Human    74 GR--------QIRVDQAGKSSDNRSRGYRGGSAGG-------------RG----------FFRGG 107
            ||        .:|:|.|.:..::|..|..||..||             ||          :.|||
  Fly    90 GRIKLDDLSAPLRIDIADRRKNDRPGGGVGGGNGGMTRGDGGRDGFQKRGPPRQGGSSQSYSRGG 154

Human   108 RGRGRGFSRGGGDRGYGGNRFESRSG---GYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDS--- 166
            .|.|.|...|||.   .|||.:||..   .|||..|    ||:..|.|...|||.....|:.   
  Fly   155 PGTGGGGREGGGG---SGNRGDSRGSYIDSYGGHND----RSRGVGGSGAGSGGGMNRGYNDRPA 212

Human   167 ----YGKSHSE 173
                ||..:::
  Fly   213 NRGRYGSFNND 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 25/83 (30%)
eIF4H1NP_001285330.1 RRM_eIF4H 24..110 CDD:409835 25/84 (30%)

Return to query results.
Submit another query.