DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and Hrb98DE

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster


Alignment Length:170 Identity:59/170 - (34%)
Similarity:84/170 - (49%) Gaps:15/170 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     7 KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMM----AM 67
            |||||.|..|.:|||:...|..:|.|.::.:|.|:||.:.|||.||.|::.|.....::    .:
  Fly   123 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQL 187

Human    68 NGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGR-GFSRGGGDRGYGGNRFESR 131
            |||.||.::....|..:......||..||.|||.   ||..|.|. |...|||:...|||.:.:.
  Fly   188 NGKMVDVKKALPKQNDQQGGGGGRGGPGGRAGGN---RGNMGGGNYGNQNGGGNWNNGGNNWGNN 249

Human   132 SGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYGKSH 171
            .||    .|.:.:.|..||   ...||.|....:|:|.::
  Fly   250 RGG----NDNWGNNSFGGG---GGGGGGYGGGNNSWGNNN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 30/81 (37%)
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:409992
RRM_SF 123..195 CDD:473069 29/71 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.