DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and Rox8

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:127 Identity:40/127 - (31%)
Similarity:66/127 - (51%) Gaps:8/127 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     3 SDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAM 67
            |....:|||.||.:...::|.:.|:.:|:||...:|:|..|.:|:|:.||:|....:|::|:.||
  Fly    92 SSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAM 156

Human    68 NGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFE 129
            ||:.:..|.||.:.:.:.........:||..||        |.|.|...|.|.:|...:.||
  Fly   157 NGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGG--------GMGGGPGNGSGVKGSQRHTFE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 27/78 (35%)
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 27/73 (37%)
RRM_SF 221..292 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.