DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and CstF64

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:75 Identity:27/75 - (36%)
Similarity:49/75 - (65%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72
            :|||.:.::..|:.|:::||:.|.:..:.:|.|||:.:.:||||..:::.:.|..||..:||..:
  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82

Human    73 DGRQIRVDQA 82
            .||.:|||.|
  Fly    83 GGRTLRVDNA 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 27/75 (36%)
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 27/75 (36%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.