DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and CG11726

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster


Alignment Length:205 Identity:39/205 - (19%)
Similarity:68/205 - (33%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    10 VGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDD------------AKD 62
            |..|..:..|..|.:||:.: .|..:.:.|  :.:|.:||.:|..::.:|            ...
  Fly    89 VSNLPMECTEGELRKVFTSF-SIRSLTIPK--KGKRPKGFAYVEMDSREDLVRLLKMDKLKCRGR 150

Human    63 AMMAMNGK-----------------SVDGRQIRVDQAGKS----------SDNRSRGYRGGSAGG 100
            .:||..|:                 :..|||..::.:..|          |...:|.....|...
  Fly   151 CLMAKIGQLPPEPPTKAAGDGFSLFTCSGRQFDINSSHYSASVSDLSTIDSPISARNSPFPSESE 215

Human   101 RGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYD 165
            ..||    ||.....|..........|.:.|........:..|.|.:|....|..:..|:.|:.|
  Fly   216 SSFF----GRDNPIKRIPSSTEEVERRMQIRLQKLAEFENSESERIKSECEDDPDAFMSWSDALD 276

Human   166 SYGKSHSEGA 175
            ...||.::.:
  Fly   277 EIRKSETDSS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 19/103 (18%)
CG11726NP_648461.1 RRM_SF 83..150 CDD:473069 13/63 (21%)

Return to query results.
Submit another query.