powered by:
Protein Alignment CIRBP and Sxl
DIOPT Version :9
Sequence 1: | NP_001287758.1 |
Gene: | CIRBP / 1153 |
HGNCID: | 1982 |
Length: | 297 |
Species: | Homo sapiens |
Sequence 2: | NP_001259303.1 |
Gene: | Sxl / 3772180 |
FlyBaseID: | FBgn0264270 |
Length: | 722 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 21/67 - (31%) |
Similarity: | 38/67 - (56%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72
|:|..|.....:..|:.:|.|||.|.:..:::|:.|.|.||..||.:...::|::|:.|:|....
Fly 205 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIP 269
Human 73 DG 74
:|
Fly 270 EG 271
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.