DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and tra2

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:170 Identity:59/170 - (34%)
Similarity:82/170 - (48%) Gaps:23/170 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    10 VGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDG 74
            |.||:.:|::..:.::|:|||.|..:.:|.|.:|||||||.|:.||.:.||:.|..:.:|..|||
  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165

Human    75 RQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRG---RGFSRGGGDRGYGGNRFESRSGG-Y 135
            |:||||   .|...|:.      ....|.:.|.:.||   |.||...|.|.|     ..||.. |
  Fly   166 RRIRVD---FSITQRAH------TPTPGVYLGRQPRGKAPRSFSPRRGRRVY-----HDRSASPY 216

Human   136 GGSRDYYSSRSQSGGYSDRSSGGSYRDSYD---SYGKSHS 172
            ...||.|..|:..  |.........|:.|.   ||.:|.|
  Fly   217 DNYRDRYDYRNDR--YDRNLRRSPSRNRYTRNRSYSRSRS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 34/79 (43%)
RRM_CIRBP_RBM3 6..85 CDD:240895 33/74 (45%)
tra2NP_476764.1 RRM <74..242 CDD:223796 54/156 (35%)
RRM_TRA2 98..175 CDD:240809 34/76 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.