DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and CG10466

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:110 Identity:32/110 - (29%)
Similarity:53/110 - (48%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     1 MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMM 65
            |..|...:||.|..:...|..|..|||:||::..:.:::|.:|.:|:||.|:.:|   |.:..::
  Fly    29 MYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYE---DQRSTVL 90

Human    66 A---MNGKSVDGRQIRVDQAG---------KSSDNRSRGYRGGSA 98
            |   :||..:..|.:|||...         |..:...|.|..|.|
  Fly    91 AVDNLNGIKILDRTLRVDHVADYKPPKENEKMDEETLRLYMEGCA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 25/90 (28%)
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 27/86 (31%)

Return to query results.
Submit another query.