DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and CG12288

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster


Alignment Length:149 Identity:31/149 - (20%)
Similarity:61/149 - (40%) Gaps:27/149 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72
            :|||.|.:...|:.|.::||..|:|..:..::|.: :..:|..:|.|:. .||....:.:|...:
  Fly   262 IFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD-KGCKGVAYVCFQK-PDAVGLALELNQTLL 324

Human    73 DGRQIRVDQ------------------AGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRG-FSRGG 118
            |.|.|.|::                  |...:.::::.....|||.:......:|:..| ..:.|
  Fly   325 DDRPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKENGSLKKEG 389

Human   119 GDRGYGGNRFESRSGGYGG 137
            ...|      :.:...|.|
  Fly   390 APTG------QKKKSEYRG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 22/99 (22%)
RRM_CIRBP_RBM3 6..85 CDD:240895 22/94 (23%)
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840
RRM_SF 261..332 CDD:302621 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.