DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and CG12288

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster


Alignment Length:156 Identity:34/156 - (21%)
Similarity:64/156 - (41%) Gaps:18/156 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72
            :|||.|.:...|:.|.::||..|:|..:..::|.: :..:|..:|.|:. .||....:.:|...:
  Fly   262 IFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD-KGCKGVAYVCFQK-PDAVGLALELNQTLL 324

Human    73 DGRQIRVD--QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGY 135
            |.|.|.|:  |..|....:.|.....||..:   ...:.:.:..:..|..:     |.:.:.|..
  Fly   325 DDRPINVERYQVKKLGAKQVRDAAAASAASK---TSSKTKAKNQNSAGAKK-----RLDKKKGKE 381

Human   136 GGSRDYYSSRSQSGGYSDRSSGGSYR 161
            .|      |..:.|..:.:.....||
  Fly   382 NG------SLKKEGAPTGQKKKSEYR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 22/78 (28%)
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828
RRM_SF 261..332 CDD:473069 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.