DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and SPAC25G10.01

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_001342863.1 Gene:SPAC25G10.01 / 3361412 PomBaseID:SPAC25G10.01 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:239 Identity:69/239 - (28%)
Similarity:102/239 - (42%) Gaps:60/239 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72
            |||.|::....|..|:|:|||:|.::.|.::::..|:.||||||::|..:::|..|:..:|.:..
pombe   103 LFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTKASRGFGFLSFSTVEEATSAIDNLNSQEF 167

Human    73 DGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESR-SGGYG 136
            .||.:.|.:|     .|||.:........|:.|  |...|.|.....|.||..|.:..| |..|.
pombe   168 YGRVLNVQKA-----KRSRPHSPTPGKYMGYDR--RRNSRDFPSNNKDGGYRRNNYRDRDSNRYR 225

Human   137 GSRDYYSSRSQSGGYSDRSSGGSYRD---SYDS--------YGKS--HSEGATLLWPAVGARFTL 188
            .|  |..||.|.     ..|.|:||.   :.||        :|:|  |:|..:            
pombe   226 NS--YRPSRPQR-----EHSPGNYRKERYNVDSRPRRERHFHGRSFAHAEHHS------------ 271

Human   189 VPS--PSTLGWTLRPCHCACPEEAHLSSQSHFYRRTQKPNETDQ 230
            ||:  ..|.|....|.|.:.|                 ||| ||
pombe   272 VPNMRNDTPGNEALPSHSSVP-----------------PNE-DQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 27/81 (33%)
RRM_CIRBP_RBM3 6..85 CDD:240895 27/76 (36%)
SPAC25G10.01NP_001342863.1 RRM 9..>225 CDD:223796 41/128 (32%)
RRM_RBMX_like 100..179 CDD:240828 27/80 (34%)
RRM 207..>283 CDD:330708 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 1 1.000 - - otm53853
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.