DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and eIF4B

DIOPT Version :10

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:167 Identity:48/167 - (28%)
Similarity:72/167 - (43%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     9 FVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVD 73
            ::..|.||.||..|.:.|.....||..:..:|.|..||||||:|..||.:|... ::::...|:.
  Fly    83 YINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIH-VLSLPDPSIK 146

Human    74 GRQIRV------DQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRS 132
            ||:||:      ||..:...||                    |..||...|.:|..|..|.:|::
  Fly   147 GRRIRIELSNENDQQSRQKSNR--------------------RFDGFGNNGDNRDSGNWRRDSQN 191

Human   133 GG--YGGS----RDYYSSRSQSGGYSDRSSGGSYRDS 163
            .|  :|.|    |.:...|.......|.::.||:|.|
  Fly   192 NGSNFGYSSNFERSFNRERKSLPDRDDVNTPGSWRTS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM_CIRBP_RBM3 6..85 CDD:409883 28/81 (35%)
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 26/76 (34%)

Return to query results.
Submit another query.