DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and hrpa-2

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_741783.1 Gene:hrpa-2 / 180791 WormBaseID:WBGene00019249 Length:336 Species:Caenorhabditis elegans


Alignment Length:249 Identity:66/249 - (26%)
Similarity:97/249 - (38%) Gaps:79/249 - (31%)


- Green bases have known domain annotations that are detailed below.


Human     7 KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAM----MAM 67
            |||:||||.||.::.|...||::|.:.:.:|::|..|:.|||||||||.:|..|:.||    ..:
 Worm    71 KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPHKL 135

Human    68 NGKSVDG-RQIRVDQAGKS------SDNRSRGYR---GGSAGG-------RGFFRG--------- 106
            .||:||. |.|..:|....      ..:.:.|.:   .|...|       |.:|..         
 Worm   136 GGKTVDSKRAIPREQMSSMIPPPFFETDPAPGCKLLLNGITNGVHSVDSLRVYFETFGTLDQVEI 200

Human   107 -GRGRGRGF----SRGGGDRGYGGN---------RFESRSGGYGGSRDYYSSRSQSGGYS----- 152
             |:.||.||    .:...||....|         :.|.|......:...|..|.||..:|     
 Worm   201 LGQPRGLGFVIYEDKESADRCLAHNSGRHIVNERKIEVRVFTKHPNGSTYWKRPQSQSHSQRDLF 265

Human   153 -----------DRSSGGSYRDSYD---------SYGKS----------HSEGAT 176
                       ||.|.|:...:.|         :||.:          |.||::
 Worm   266 EQLSQLNLKDGDRKSTGNSSSAADTPQNFDEDSNYGGTTTEDDCNVFEHEEGSS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 36/93 (39%)
RRM_CIRBP_RBM3 6..85 CDD:240895 36/82 (44%)
hrpa-2NP_741783.1 RRM <62..230 CDD:223796 49/158 (31%)
RRM1_hnRNPA_like 71..148 CDD:241022 35/76 (46%)
RRM_SF 183..240 CDD:302621 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.