DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and rsp-6

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_741446.1 Gene:rsp-6 / 177566 WormBaseID:WBGene00004703 Length:179 Species:Caenorhabditis elegans


Alignment Length:175 Identity:63/175 - (36%)
Similarity:93/175 - (53%) Gaps:18/175 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     5 EGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNG 69
            :.|::||||..|...|.||::|.::|:|.:|.|.:     |..||.||.::::.||:||:.|::|
 Worm     2 DAKVYVGGLPSDATSQELEEIFDRFGRIRKVWVAR-----RPPGFAFVEYDDVRDAEDAVRALDG 61

Human    70 KSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGF-------FRGGRGRGRGFSRGGGDRGYGGNR 127
            ..:.|.:.||:.:  :...|..|.|||..||||.       :||.|||.|..||   |||...:|
 Worm    62 SRICGVRARVELS--TGQRRGGGGRGGGFGGRGGGGRDRSPYRGDRGRSRSRSR---DRGRDRSR 121

Human   128 FESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYGKSHS 172
            ..||......|||....||:....: ||...|.::...|:.||.|
 Worm   122 DRSRDRSRDRSRDRSRERSRERERT-RSRSRSPQERDRSHSKSRS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 28/84 (33%)
RRM_CIRBP_RBM3 6..85 CDD:240895 28/78 (36%)
rsp-6NP_741446.1 RRM <2..>75 CDD:223796 28/79 (35%)
RRM_SRSF3_like 4..75 CDD:240819 28/77 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S1239
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.