DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and rsp-8

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_001255142.1 Gene:rsp-8 / 176613 WormBaseID:WBGene00004705 Length:309 Species:Caenorhabditis elegans


Alignment Length:226 Identity:76/226 - (33%)
Similarity:99/226 - (43%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72
            |.|..||..|.|:.|..||.::|:|::..:|.||.:..||||||:.|..|:||..|...:....:
 Worm    78 LGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDATAARDKLCNTDL 142

Human    73 DGRQIRVD-------------------QAGKSSDN-----------RSRGYRGGSAGGRGFFRGG 107
            ||.:||||                   :.|.||..           ..||.|||...| |..|||
 Worm   143 DGHKIRVDFSLTKRGHSPTPGQYMGDRRGGGSSGGGRFGGGGGDRFNDRGSRGGDRYG-GDRRGG 206

Human   108 RGRGRG--FSRGGGDRGYGGNRF---------ESRSGGY---GGSRDYYSSRSQSGG-------Y 151
            .|.|.|  :..||||| |||:|:         ..|.||:   ||...|..|....||       .
 Worm   207 GGGGGGDRYGGGGGDR-YGGDRYGGGGGRRGSPDRRGGFRSGGGGGGYMRSGGGGGGPDRRDHRD 270

Human   152 SDRSSGG--------SYRDSYDSYGKSHSEG 174
            :||:.||        |:|...:|||..:|.|
 Worm   271 NDRNGGGGGHRPYDPSFRRRVESYGSGNSGG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 34/111 (31%)
RRM_CIRBP_RBM3 6..85 CDD:240895 32/95 (34%)
rsp-8NP_001255142.1 RRM_TRA2 77..154 CDD:240809 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I6299
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.