DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and rbm-3.2

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_493023.1 Gene:rbm-3.2 / 173071 WormBaseID:WBGene00011156 Length:85 Species:Caenorhabditis elegans


Alignment Length:83 Identity:34/83 - (40%)
Similarity:45/83 - (54%) Gaps:4/83 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     8 LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSV 72
            ::||...|.|.|..|...||:.|.:|.|.:|.||||.|.|||.||.|.....|:.|:...||...
 Worm     6 VYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEEAAAQRAVDQFNGVDF 70

Human    73 DGRQIRVDQAGKSSDNRS 90
            :||.:||:.|    .||:
 Worm    71 NGRALRVNLA----QNRN 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 33/81 (41%)
RRM_CIRBP_RBM3 6..85 CDD:240895 32/76 (42%)
rbm-3.2NP_493023.1 RRM_SF 7..81 CDD:388407 32/77 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100265
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.