DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIRBP and Cirbp

DIOPT Version :9

Sequence 1:NP_001287758.1 Gene:CIRBP / 1153 HGNCID:1982 Length:297 Species:Homo sapiens
Sequence 2:NP_001366350.1 Gene:Cirbp / 12696 MGIID:893588 Length:176 Species:Mus musculus


Alignment Length:175 Identity:164/175 - (93%)
Similarity:167/175 - (95%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMM 65
            ||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMM 65

Human    66 AMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFES 130
            |||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||.||||
Mouse    66 AMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFES 130

Human   131 RSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYGKSHSEGA 175
            ||||||||||||:||||.|.|..|||||||||||||||||.|:.|
Mouse   131 RSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYGKSSSKDA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIRBPNP_001287758.1 RRM <3..>90 CDD:223796 85/86 (99%)
RRM_CIRBP_RBM3 6..85 CDD:240895 77/78 (99%)
CirbpNP_001366350.1 RRM_CIRBP_RBM3 6..85 CDD:409883 77/78 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83972869
Domainoid 1 1.000 186 1.000 Domainoid score I27464
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H980
Inparanoid 1 1.050 336 1.000 Inparanoid score I14653
Isobase 1 0.950 - 0.928771 Normalized mean entropy S1239
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG43500
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 1 1.000 - - oto119143
orthoMCL 1 0.900 - - OOG6_100265
Panther 1 1.100 - - LDO PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X860
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1616.350

Return to query results.
Submit another query.