DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCTD12 and CG14647

DIOPT Version :10

Sequence 1:NP_612453.1 Gene:KCTD12 / 115207 HGNCID:14678 Length:325 Species:Homo sapiens
Sequence 2:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster


Alignment Length:148 Identity:52/148 - (35%)
Similarity:69/148 - (46%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    19 GSGSSSSSAEPPLFPDI----------VELNVGGQVYVTRRCTVVS-VPDSLLWRMFTQ---QQP 69
            |||:....|.|.....:          |:||||||:|.|...|:|. .|||:|.|||.|   .:|
  Fly     9 GSGARKDDAAPAAGDFVAASGFAPNRWVKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMKP 73

Human    70 QELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELV----RRLG 130
            .|  ||.:|.:.:||....|..|::|||..|.|..........|: ||.:|.:..||    .|||
  Fly    74 SE--RDEQGAYLIDRSPRYFEPIINYLRHGQFVCDSNISVLGVLE-EARFFGIFSLVTHLEERLG 135

Human   131 APQQPGPGPPPSRRGVHK 148
            ..:.|....|.:|..|.|
  Fly   136 QQETPLGDRPLTRNDVIK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCTD12NP_612453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 3/8 (38%)
BTB_POZ 32..131 CDD:453885 41/116 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..202 7/20 (35%)
H1_KCTD12 206..325 CDD:409028
CG14647NP_649465.6 BTB_POZ_KCTD9 34..134 CDD:349677 39/102 (38%)
YjbI 161..322 CDD:440968
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.