DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCTD12 and CG10465

DIOPT Version :10

Sequence 1:NP_612453.1 Gene:KCTD12 / 115207 HGNCID:14678 Length:325 Species:Homo sapiens
Sequence 2:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster


Alignment Length:106 Identity:41/106 - (38%)
Similarity:60/106 - (56%) Gaps:6/106 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    36 VELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQ 100
            ::|||||.:|.|...|:....|::|..||:.:  .|:..||:|...:||.|..|..||:||||..
  Fly    21 LKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGR--MEVLTDSEGWILIDRCGNHFGIILNYLRDGT 83

Human   101 LVLPDYFPERSRLQREAEYFELPELV----RRLGAPQQPGP 137
            :.||:...|.:.|..||:|:.:.||.    |.|.|.|:|.|
  Fly    84 VPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEPKP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCTD12NP_612453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
BTB_POZ 32..131 CDD:453885 37/98 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..202 5/9 (56%)
H1_KCTD12 206..325 CDD:409028
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 35/92 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.