DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCTD12 and inc

DIOPT Version :10

Sequence 1:NP_612453.1 Gene:KCTD12 / 115207 HGNCID:14678 Length:325 Species:Homo sapiens
Sequence 2:NP_569926.2 Gene:inc / 31110 FlyBaseID:FBgn0025394 Length:211 Species:Drosophila melanogaster


Alignment Length:94 Identity:34/94 - (36%)
Similarity:53/94 - (56%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    36 VELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQ 100
            |:|||||..::|.:.|:...|:|.|.|:..:.......||..|.:.:|||...|..:|:|||..:
  Fly    24 VKLNVGGTYFLTTKTTLSRDPNSFLSRLIQEDCDLISDRDETGAYLIDRDPKYFAPVLNYLRHGK 88

Human   101 LVLPDYFPERSRLQREAEYFELPELVRRL 129
            ||| |...|...|: |||::.:.:|:..|
  Fly    89 LVL-DGVSEEGVLE-EAEFYNVTQLIALL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCTD12NP_612453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
BTB_POZ 32..131 CDD:453885 34/94 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..202 1/1 (100%)
H1_KCTD12 206..325 CDD:409028
incNP_569926.2 BTB_POZ_KCTD2-like 23..106 CDD:349671 32/83 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.