DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHPN1 and rhpn1

DIOPT Version :10

Sequence 1:XP_005250829.1 Gene:RHPN1 / 114822 HGNCID:19973 Length:723 Species:Homo sapiens
Sequence 2:NP_001008116.1 Gene:rhpn1 / 493478 XenbaseID:XB-GENE-970431 Length:706 Species:Xenopus tropicalis


Alignment Length:77 Identity:16/77 - (20%)
Similarity:35/77 - (45%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    36 KSEKYKNCTHLIAERLCKSEKFLAACA-----AGK---WILTKDYIIHSAKSGRWLDETTYEWGY 92
            |.|:.:.|.|::.|.: ::.|.....|     .||   :|:.::.::..|......|..|:...:
 Frog   152 KIEQLRYCQHVLCETV-RTAKLTPVSAQLQDIEGKIDRFIIPRETLVLYALGVVLQDPNTWPSPH 215

Human    93 KIEKDSRYSPQM 104
            |.:.| |:..::
 Frog   216 KFDPD-RFDDEL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHPN1XP_005250829.1 HR1 74..158 CDD:469609 6/31 (19%)
BRO1_Rhophilin_1 162..546 CDD:185771
PDZ_rhophilin-like 566..641 CDD:467196
rhpn1NP_001008116.1 HR1_Rhophilin-1 24..108 CDD:212023
BRO1_Rhophilin_1 112..496 CDD:185771 16/77 (21%)
PDZ_rhophilin-like 514..591 CDD:467196
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.