DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARD16 and casp1

DIOPT Version :10

Sequence 1:NP_443121.1 Gene:CARD16 / 114769 HGNCID:33701 Length:97 Species:Homo sapiens
Sequence 2:XP_012813105.2 Gene:casp1 / 100491605 XenbaseID:XB-GENE-485195 Length:408 Species:Xenopus tropicalis


Alignment Length:84 Identity:32/84 - (38%)
Similarity:45/84 - (53%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     6 LKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ 70
            ||:.|||||.......||.|||:||...||...|:|.:...||...|:.|.:||::..||..:..
 Frog     5 LKKVRKLFIDGCNAAIINNLLDDLLDKSVLTDSEVEYINECNAITKDRCRRMIDNIKNKGDYSSN 69

Human    71 ICITYICEEDSYLAETLGL 89
            |.:..:.|....||:.:||
 Frog    70 ILLQCLVENHKTLAKNMGL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARD16NP_443121.1 CARD_CASP1-like 5..87 CDD:260036 30/80 (38%)
casp1XP_012813105.2 DD 4..86 CDD:472698 30/80 (38%)
CASc 158..406 CDD:214521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.