DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARD16 and casp1

DIOPT Version :9

Sequence 1:XP_011540885.1 Gene:CARD16 / 114769 HGNCID:33701 Length:265 Species:Homo sapiens
Sequence 2:XP_012813105.2 Gene:casp1 / 100491605 XenbaseID:XB-GENE-485195 Length:408 Species:Xenopus tropicalis


Alignment Length:111 Identity:37/111 - (33%)
Similarity:53/111 - (47%) Gaps:8/111 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    74 LKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ 138
            ||:.|||||.......||.|||:||...||...|:|.:...||...|:.|.:||::..||..:..
 Frog     5 LKKVRKLFIDGCNAAIINNLLDDLLDKSVLTDSEVEYINECNAITKDRCRRMIDNIKNKGDYSSN 69

Human   139 ICITYICEEDSYLAETLGLSAALQAVQDNPAMP--------TCSSP 176
            |.:..:.|....||:.:||..:..|:...|.:.        |.|.|
 Frog    70 ILLQCLVENHKTLAKNMGLDVSESAIAPQPILEQNKKTNENTVSEP 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARD16XP_011540885.1 CARD_CASP1-like 73..155 CDD:260036 30/80 (38%)
casp1XP_012813105.2 DD 4..86 CDD:417479 30/80 (38%)
CASc 158..406 CDD:214521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I39323
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1327703at2759
OrthoFinder 1 1.000 - - FOG0002802
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.