DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ferd3l and Fer1

DIOPT Version :9

Sequence 1:NP_277057.1 Gene:Ferd3l / 114712 MGIID:2150010 Length:168 Species:Mus musculus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:122 Identity:45/122 - (36%)
Similarity:70/122 - (57%) Gaps:27/122 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    66 GDEVEYEDPEEEEEEGEG-----------------RGRVASLLGRPKRKRVITY--AQRQAANIR 111
            |||...|..:|::....|                 |..      :|:|.:..:.  .||||||:|
  Fly    36 GDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSH------KPRRLKCASQMAQQRQAANLR 94

Mouse   112 ERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEEKEAS 168
            ||:||.::||||:.||..:||..||||||:::||:|||.||:|::|::  |::|..:
  Fly    95 ERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMV--KKDKNGN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ferd3lNP_277057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88 7/38 (18%)
bHLH domain 104..159 34/54 (63%)
HLH 104..156 CDD:278439 33/51 (65%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.