DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actb and Arp10

DIOPT Version :9

Sequence 1:NP_031419.1 Gene:Actb / 11461 MGIID:87904 Length:375 Species:Mus musculus
Sequence 2:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster


Alignment Length:385 Identity:83/385 - (21%)
Similarity:155/385 - (40%) Gaps:64/385 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIE 72
            :|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||          
  Fly    14 IVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR---------- 51

Mouse    73 HGIVTNWDDMEKIWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 130
               :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|..|:..
  Fly    52 ---LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVS 113

Mouse   131 AMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195
            ::......:::|......|.:|:|.|...|..:|::.|..:..|.......|..:...:.:.|.|
  Fly   114 SVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVE 178

Mouse   196 RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNE------- 253
            .|...:...| .::.|||.:.|:|.   ..|.|.|.::....:....||...|...|:       
  Fly   179 SGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVPG 239

Mouse   254 --RFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 316
              |....|.:|:.|   .|...:......||:.|.:|:|:.|..:..|.||.:|..|:..|:::|
  Fly   240 LLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQE 301

Mouse   317 ITALAP----------STMKIKII-APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 365
            :..|..          ..::.|.. |..::.::.|:||::..:....|...:.|:.|.:|
  Fly   302 LQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbNP_031419.1 PTZ00281 1..375 CDD:173506 83/385 (22%)
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 78/362 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 83/385 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.