DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlk1 and NimB2

DIOPT Version :9

Sequence 1:XP_038967531.1 Gene:Dlk1 / 114587 RGDID:619931 Length:416 Species:Rattus norvegicus
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:257 Identity:73/257 - (28%)
Similarity:106/257 - (41%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Rat    59 CDPAC--DPQHGFCEADNVCRCEPGWEGPLCEKCV-TSP-GCVNGLCEEPWQCVCKEGWD----- 114
            |:|.|  |.::|.|.|.|.|.|.||.......||: |.| ||.||:|:|..:|.|:||:.     
  Fly   181 CEPICADDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYSLEPET 245

  Rat   115 GKFCEIDIRACTSTPCANNGTCVDLEKGQYECSCTPGF----------------SGK-----DCQ 158
            .|:|:.:.:     |..:.|.||...|    |:|..|:                :||     .|.
  Fly   246 RKYCQPECK-----PGCSFGRCVAPNK----CACLDGYRLAADGSCEPVCDSCENGKCTAPGHCN 301

  Rat   159 HKAGPCVINGS-------PCQHGGACVDDEGRASHASCLCPPGFSGNFCEIVTNSCTPN---PCE 213
            ..||...:.|.       ||:: |.|:..:      .|.|..||.   .:..:..|.|.   ||.
  Fly   302 CNAGYLKLQGRCEPICSIPCKN-GRCIGPD------ICECASGFE---WDRKSAECLPKCDLPCL 356

  Rat   214 NDGVCTDIGGDFRCRCPAGFVDKTCSRPV--SNCASGPCLNGGTCLQHTQVSFECLCKPPFM 273
            | |||.   |:.:|.|..|:|.....|.:  .:|..| |.||     :......|:|:|.|:
  Fly   357 N-GVCV---GNNQCDCKTGYVRDEHQRNICQPHCPQG-CQNG-----YCSAPNFCICRPGFI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlk1XP_038967531.1 EGF_CA 121..158 CDD:238011 10/57 (18%)
EGF_CA 168..201 CDD:238011 9/39 (23%)
EGF_CA 208..238 CDD:238011 12/32 (38%)
EGF_CA 245..277 CDD:238011 9/29 (31%)
NimB2NP_723857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.