DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncam1b and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_005157462.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1055 Species:Danio rerio
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:394 Identity:89/394 - (22%)
Similarity:146/394 - (37%) Gaps:85/394 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish    95 VASSGDQDAE--------ATVNLKIYQKITFTNVPSPQEFTEGDNAIIVCDVISSPPPTVLWKYK 151
            ||.|.|..:|        :|:|..|.:...||:|........|.|..:.|.|.:      |..||
  Fly    24 VALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKN------LGSYK 82

Zfish   152 GAKIQFD-------------KDVRFKTLSNNH-------LQIRGIRKTDEGVYTCE-GRIKARGE 195
            .|.:.|:             ::.|.....:.|       |.|..:::.|.|.|.|: ..:.|:.:
  Fly    83 VAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQ 147

Zfish   196 VDFRSIKVVVNVLPTIRIRQAETNATADMGFSTLLACDPDGFPEPIVTWRRNNAPLESGNKYSFN 260
            ..|  :||||.  |.|......::.....|.:..|.|...|.|||.:.|:|     :.|||...|
  Fly   148 YGF--VKVVVP--PNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKR-----DDGNKIVIN 203

Zfish   261 E-------DGSEMTVLDVTKLDEGDYTCIAKNKAGES-EQELSLKVFVQPKITYLESQTTTEMDE 317
            :       :...:.:..:::|..|.|.|||.|....| .:.:.:.|...|.:..........:..
  Fly   204 KTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGF 268

Zfish   318 QVTLTCEATGDPTPTITWSFGTRVFTEGEQEQQKRIYQASWTRPEQHKG-PDGEVLVRSDARVSS 381
            .:||.|....:||....|:          :|..:.|.::|..:.|...| |..:..:|       
  Fly   269 NITLECFIEANPTSLNYWT----------RENDQMITESSKYKTETIPGHPSYKATMR------- 316

Zfish   382 LTLKYPQYTDAGQYLCTARNAIGE-------------TVQ--PVSLEVRYAPKILGSVAVYTWEG 431
            ||:...|.:|.|.|.|.|:|..|:             |.|  |.:..:|........:|:..:..
  Fly   317 LTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYIN 381

Zfish   432 NPAN 435
            .|.|
  Fly   382 TPLN 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncam1bXP_005157462.1 Ig 20..112 CDD:299845 7/24 (29%)
I-set 21..111 CDD:254352 7/23 (30%)
IG_like 121..205 CDD:214653 21/104 (20%)
IGc2 128..189 CDD:197706 17/81 (21%)
Ig 208..301 CDD:299845 24/100 (24%)
I-set 212..298 CDD:254352 21/93 (23%)
I-set 298..414 CDD:254352 28/131 (21%)
Ig 300..414 CDD:299845 27/129 (21%)
IG_like 426..505 CDD:214653 2/10 (20%)
Ig 434..505 CDD:143165 1/2 (50%)
FN3 513..606 CDD:238020
FN3 629..720 CDD:238020
Chorion_3 <815..1019 CDD:253174
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 21/103 (20%)
Ig 69..139 CDD:143165 15/75 (20%)
IG_like 165..249 CDD:214653 21/88 (24%)
IGc2 172..237 CDD:197706 20/69 (29%)
IG_like 267..348 CDD:214653 23/97 (24%)
Ig 270..339 CDD:299845 22/85 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.