DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncam2 and DIP-delta

DIOPT Version :9

Sequence 1:NP_571905.1 Gene:ncam2 / 114441 ZFINID:ZDB-GENE-010822-1 Length:795 Species:Danio rerio
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:432 Identity:93/432 - (21%)
Similarity:162/432 - (37%) Gaps:102/432 - (23%)


- Green bases have known domain annotations that are detailed below.


Zfish   197 RNIILVVNVPPVVSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWHRKGVQLQESERYVMRARG 261
            |.:||.::...:..:|:.          |:|:|         |.||                   
  Fly    82 RQMILTIHRHVISRIPRY----------SITYT---------DNTW------------------- 108

Zfish   262 TTLTVRNIQQDDGGSYTCRASNKAGEVEHELFLKVFVQPHITKLR----NVTAVEGSAAMISCKA 322
             .|.|....|||.|.|.|:. |....:....:|:|.|.|:|..:.    :|...|.....::|:|
  Fly   109 -LLHVNQAHQDDRGYYMCQV-NTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171

Zfish   323 EGEPLPEISWRRASDGHSFSDGDKSPDGRVEVRGR---YGESMLTIVVVKLSDWGRFDCEALSRI 384
            :|.|.|:|.||| .||...:         ||.:.:   |...:|.:..|..::.|.:.|.|.:.:
  Fly   172 DGFPAPKIIWRR-EDGEEIA---------VEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGV 226

Zfish   385 -GGHQKSMFLDIEYAPKFQANHTIFFSWEGNPVNISCDVMSNPPATMLW-RREKLTIPSE----- 442
             ....|.:.||:|::|.....:.:..:..|..|.|.|...::|.|.:.| ....:.:||:     
  Fly   227 PPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTD 291

Zfish   443 -GAGNMRVYTAPGRSLLEVTPMSDRDFGRYNCTARNNIGMRFQEFILAQADVPSNPYSVRLSSVA 506
             ...:.|.:..     |.:..:...|||.|.|.::|::|         :.:.....|.:.|.|..
  Fly   292 YTENSYRAHMK-----LTIRNLQYGDFGNYRCISKNSLG---------ETEGSIRVYEIPLPSTP 342

Zfish   507 QRVATVTFTKPDSHGGVPISHYLVKYKDISSQDWKDVKSLGTQTIVLLTN-LEPNTTYEVRVSAV 570
            .:..|.|..:...:..:|           ||:: ...|||.|.....:.| |.|.:.    .|:.
  Fly   343 SKQVTHTTVESRENNIIP-----------SSRN-DTTKSLQTDVGYAMKNDLYPGSA----SSSS 391

Zfish   571 NGKGQGEFSHTESFQTLPI------REPSPPSVQGQRGVGKA 606
            :|......|.:.|.||..:      ...|....:|...:||:
  Fly   392 SGGSSSAASSSSSMQTSALPGGVAGNSLSSMGSKGSLAIGKS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncam2NP_571905.1 Ig1_NCAM-2 20..111 CDD:143274
I-set 21..110 CDD:254352
IGc2 127..187 CDD:197706
Ig 213..299 CDD:299845 17/85 (20%)
I-set 213..296 CDD:254352 16/82 (20%)
Ig 298..395 CDD:299845 26/104 (25%)
I-set 300..393 CDD:254352 24/100 (24%)
IG_like 411..488 CDD:214653 18/83 (22%)
IGc2 412..480 CDD:197706 17/74 (23%)
FN3 494..586 CDD:238020 19/92 (21%)
fn3 <616..675 CDD:278470
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 21/100 (21%)
Ig 145..238 CDD:416386 25/102 (25%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 2/6 (33%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 19/104 (18%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/14 (14%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/17 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.