DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f7 and flz

DIOPT Version :9

Sequence 1:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:138/269 - (51%) Gaps:30/269 - (11%)


- Green bases have known domain annotations that are detailed below.


Zfish   174 CGKVPLLQAGKAADHQVDLRSRIVGGSECPKGHCPWQVLLKYG------EKGFCGGVIYKPTWIL 232
            ||..|.:::|           |||||.....|..|||||::..      .|..||||:....:::
  Fly  1438 CGVRPHVKSG-----------RIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVI 1491

Zfish   233 TAAHCLEKLKVKFLRIVAGEHDLEVDEGTEQLI--QVDQMFTHPAYVSETADSDIALLRLRTPIV 295
            |||||........:.:: ||.|:..|..:::.:  .|.::..|..|...|.::|:|||.|.:|:.
  Fly  1492 TAAHCQPGFLASLVAVM-GEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQ 1555

Zfish   296 YSVYAVPVCLPLREMAERELWAVSKHTVSGWGKRSEDGPTSRLLRRLLVPRIRTQECVQV----- 355
            :..:.||:|:| .::|:   :.....||:|||:....|....:|:.:.||.|....|.::     
  Fly  1556 FDTHIVPICMP-NDVAD---FTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAG 1616

Zfish   356 SNLTLTSNMFCAGYIEGRQDSCKGDSGGPLVTRYRDTAF-LLGIVSWGKGCARPGSYGIYTRVSN 419
            .|..:.::..||||..|::|||:||||||||.:..|..: |.|.||.|..||.|...|:|.|.:.
  Fly  1617 HNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTF 1681

Zfish   420 YLQWIRQTT 428
            |..|:|..|
  Fly  1682 YKPWLRSIT 1690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342
Tryp_SPc 195..424 CDD:214473 81/242 (33%)
Tryp_SPc 196..427 CDD:238113 82/244 (34%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 82/244 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.