DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neurod6a and CG33557

DIOPT Version :9

Sequence 1:XP_017209288.1 Gene:neurod6a / 114414 ZFINID:ZDB-GENE-010608-1 Length:391 Species:Danio rerio
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:109 Identity:42/109 - (38%)
Similarity:58/109 - (53%) Gaps:18/109 - (16%)


- Green bases have known domain annotations that are detailed below.


Zfish   111 DDDDSEKDEDEREDGQDENGLPRRRGPRKKKMTKARVDRVKVRRMEANARERNRMHGLNNALDSL 175
            |.:||:..::....||:..|..|||.||:|                .|||||.|...:|:|.::|
  Fly    36 DSEDSQIGQEANPGGQENQGNHRRRPPRQK----------------INARERYRTFNVNSAYEAL 84

Zfish   176 RKVVPCYSKTQKLSKIETLRLAKNYIWALSEILSTGK--RPDLL 217
            |.::|.....:||||||.:|||.:||..||..|.||.  :|.||
  Fly    85 RNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTECQPCLL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neurod6aXP_017209288.1 None
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.