DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angpt2b and CG31832

DIOPT Version :9

Sequence 1:NP_571889.1 Gene:angpt2b / 114408 ZFINID:ZDB-GENE-010817-2 Length:489 Species:Danio rerio
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:204 Identity:83/204 - (40%)
Similarity:112/204 - (54%) Gaps:9/204 - (4%)


- Green bases have known domain annotations that are detailed below.


Zfish   288 NGIYSIHLPNSTQKIKVFCDMKTKGGGWTVFQHRYDGSVDFNRDWNDYKLGFGDPSGEHWLGNDV 352
            |||:.:.||.........|  ||....|.|.|.|.||||:||:.|..||.|||||:||.::|...
  Fly    31 NGIHQLMLPEEEPFQVTQC--KTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQK 93

Zfish   353 IHLLTTTKDYTLQVHLKDAEEHQAYSQYDTFYIDGEDKKYSLHARG-FSGTAGRTSSLTHSGTQF 416
            ::|:|..:.:.|.:.||.......|:.:|.|.:|.|.:.|.|...| :||||| .|...|...:|
  Fly    94 LYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG-DSLRYHINKRF 157

Zfish   417 STKDQDNDQCSCKCAQMATGGWWFEACGPSNLNGIYY-SGNSNVIRYNSIKWYYWKGPSWMATMT 480
            ||.|:|||:.|..||....|||||.:|..|:|||:|: .|.:.::  |.|.|..||..|  .|..
  Fly   158 STFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGML--NGIHWGRWKFQS--LTFV 218

Zfish   481 TMMIRPVDF 489
            .:||||..|
  Fly   219 QIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angpt2bNP_571889.1 NYD-SP28 164..244 CDD:291438
FReD 274..487 CDD:238040 81/200 (41%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 81/200 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.