Sequence 1: | NP_571889.1 | Gene: | angpt2b / 114408 | ZFINID: | ZDB-GENE-010817-2 | Length: | 489 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723894.2 | Gene: | CG31832 / 318970 | FlyBaseID: | FBgn0051832 | Length: | 227 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 83/204 - (40%) |
---|---|---|---|
Similarity: | 112/204 - (54%) | Gaps: | 9/204 - (4%) |
- Green bases have known domain annotations that are detailed below.
Zfish 288 NGIYSIHLPNSTQKIKVFCDMKTKGGGWTVFQHRYDGSVDFNRDWNDYKLGFGDPSGEHWLGNDV 352
Zfish 353 IHLLTTTKDYTLQVHLKDAEEHQAYSQYDTFYIDGEDKKYSLHARG-FSGTAGRTSSLTHSGTQF 416
Zfish 417 STKDQDNDQCSCKCAQMATGGWWFEACGPSNLNGIYY-SGNSNVIRYNSIKWYYWKGPSWMATMT 480
Zfish 481 TMMIRPVDF 489 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
angpt2b | NP_571889.1 | NYD-SP28 | 164..244 | CDD:291438 | |
FReD | 274..487 | CDD:238040 | 81/200 (41%) | ||
CG31832 | NP_723894.2 | FReD | 28..225 | CDD:238040 | 81/200 (41%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |