DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angpt1 and CG31832

DIOPT Version :9

Sequence 1:NP_571888.1 Gene:angpt1 / 114407 ZFINID:ZDB-GENE-010817-1 Length:513 Species:Danio rerio
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:200 Identity:75/200 - (37%)
Similarity:118/200 - (59%) Gaps:10/200 - (5%)


- Green bases have known domain annotations that are detailed below.


Zfish   312 NGVYTINISPQETKKV-YCVMESAGGGWTVIQKREDGTVDFQKTWKEYKMGFGSVSGEHWLGNEF 375
            ||::.:.:..:|..:| .|  ::....|.|||:|.||:|:|.::|..||.|||..:||.::|.:.
  Fly    31 NGIHQLMLPEEEPFQVTQC--KTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQK 93

Zfish   376 VHVLTNQRQHGLRVELSDWDGHQAFSQYDSFHIDSEKQKYRL-FLKTHSGTAGRQSSLAVH-GAD 438
            ::::|.::.|.|.::|....|...::.:|.|.:|||.:.|:| .:..:|||||  .||..| ...
  Fly    94 LYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG--DSLRYHINKR 156

Zfish   439 FSTKDVDNDNCTCKCALMLSGGWWYDACGPSNLNGVYYRQGQHVGKFNGIKWHYFKGPSYSLRST 503
            |||.|.|||..:..||....||||:.:|..|:|||:|:|:|: .|..|||.|..:|  ..||...
  Fly   157 FSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGE-TGMLNGIHWGRWK--FQSLTFV 218

Zfish   504 VMMIR 508
            .:|||
  Fly   219 QIMIR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angpt1NP_571888.1 RILP-like <206..272 CDD:304877
FReD 298..508 CDD:238040 73/198 (37%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 74/199 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.